foam for noise reduction

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Categories:EVA Foam Underlayment

Country/Region:china

... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is with a 3 mm thick foam layer that provides optimal cushioning and sound absorption, as well as

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Brand Name:Future Tech

Model Number:FT004

Place of Origin:Shenzhen China

Description of the Hot Sale High Quality Safety Silicone Reusable Ear Plugs for personal hearing proctection Description of Reusable Ear plugs : Material The ear plugs are made of silicone, which is soft and comfortable to wear, the cord is made of nylon...

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

Brand Name:EkkoFlex

Place of Origin:Made in china

10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduction applications. Its dense, crosslinked structure effectively absorbs and dampens sound vibrations, ...

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

Brand Name:Aonike

Model Number:BT800

Place of Origin:China

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ...

Brand Name:huashida

Place of Origin:Qingdao, China

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-...

Place of Origin:China

Brand Name:AEROPAK

Model Number:APK-8620

750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam 750ml Expanding Tube Foam Multi Purpose Construction Use Noise Resistant Description: I-Like PU Foam Sealant is made of high quality one-component polyurethane material. It has a ...

Brand Name:Blx-Silicone

Model Number:SN 001

Place of Origin:China

... with waterproof function. This product is multi-scene applicable, designed for noise reduction and noise prevention during sleep, quietness during studying, and waterproof protection during swimming, integrating comfort, durability, noise reduction and

Brand Name:HONTECK

Model Number:CR0515B

Place of Origin:China

CR Sealed Foam CR0515B Heat-Resistant And Fire Resistant For Civil Engineering Product introduction CR rubber and plastic products are new environment-friendly plastic foam materials 1,introduce CR rubber and plastic products are new environment-friendly ...